Submit a new custom target (antigen) for staff review. At least one of
sequence or pdb_id must be provided. The product_id must be unique
within your organization.
New requests are created with pending_review status. Staff will review
and approve or reject the request. Approved targets receive a material_id
linking them to the catalog.
Biscuit-based bearer token. Obtain tokens from the Adaptyv Portal or via the /tokens endpoint. Tokens encode organization membership and role-based capabilities; the API verifies the token's cryptographic signature and authorization claims before processing requests. Use /tokens/attenuate to create restricted tokens for delegation.
Request payload for submitting a custom target with sequence or PDB data.
Users can submit their own targets for review. At least one of sequence
or pdb_id must be provided. Approved targets are added to the catalog
and can be used in experiments.
Display name for the target
"My Custom Antigen"
User-provided identifier, must be unique within your organization
"CUSTOM-001"
Molecular weight in kilodaltons (kDa)
15.5
Additional notes or context about the target
"Expressed in HEK293 cells"
Base64-encoded PDB file content for custom structures not in the PDB
PDB database identifier (e.g., "1ABC", "6LU7")
"1HHO"
URL to vendor product page or documentation
"https://www.acrobiosystems.com/product/PD1"
Amino acid sequence using standard single-letter codes (A-Z excluding B, J, X, Z). Supports standard 20 amino acids plus selenocysteine (U) and pyrrolysine (O).
"MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
Source vendor name if applicable
"ACRO Biosystems"
Request submitted successfully
Response after submitting a custom target request.