> ## Documentation Index > Fetch the complete documentation index at: https://docs.adaptyvbio.com/llms.txt > Use this file to discover all available pages before exploring further. # Submit custom target request > Submit a new custom target (antigen) for staff review. At least one of `sequence` or `pdb_id` must be provided. The `product_id` must be unique within your organization. New requests are created with `pending_review` status. Staff will review and approve or reject the request. Approved targets receive a `material_id` linking them to the catalog. ## OpenAPI ````yaml https://devs.adaptyvbio.com/api/v1/openapi.json post /api/v1/targets/request-custom openapi: 3.1.0 info: title: Adaptyv Foundry API description: > The Foundry API enables programmatic access to Adaptyv Bio's protein characterization services. ## Getting Started 1. **Obtain an API token** from the [Adaptyv Portal](https://foundry.adaptyvbio.com) or by contacting Adaptyv directly 2. **Authenticate requests** using Bearer token in the Authorization header 3. **Create experiments** to submit protein sequences for characterization 4. **Monitor status** via webhooks or polling the experiment detail endpoint ## Authentication All requests require a Bearer token: ``` Authorization: Bearer ``` Tokens can be attenuated (restricted) to specific organizations or capabilities via the `/tokens` endpoint. ## Pagination List endpoints support offset-based pagination: | Parameter | Description | Default | |-----------|-------------|---------| | `limit` | Maximum items per page | 50 | | `offset` | Number of items to skip | 0 | ## Filtering Most list endpoints support filtering via query parameters using comparison operators: - `equ(field)=value` — equals - `geq(field)=value` — greater than or equal - `gtr(field)=value` — greater than - `leq(field)=value` — less than or equal - `lss(field)=value` — less than Example: `GET /experiments?geq(created_at)=2025-01-01&status=draft` ## Environments | Environment | Base URL | |-------------|----------| | Production | `https://foundry-api-public.adaptyvbio.com` | ## Support - **Email**: support@adaptyvbio.com - **Documentation**: [docs.adaptyvbio.com](https://docs.adaptyvbio.com) version: 0.0.2 servers: - url: https://foundry-api-public.adaptyvbio.com/ description: Production API (Public) security: - adaptyv_biscuits_v0: [] tags: - name: experiments description: > Experiments are the core resource for submitting protein sequences to Adaptyv's characterization services. ## Lifecycle Experiments progress through these stages: 1. **Draft** — Initial state for designing your experiment 2. **In Review** — Submitted for validation and quote generation 3. **Quote Sent** — Adaptyv has sent a pricing quote 4. **Waiting for Confirmation** — Quote ready, awaiting acceptance 5. **In Queue** — Confirmed and queued for lab scheduling 6. **Waiting for Materials** — Confirmed, waiting for samples 7. **In Production** — Lab work in progress 8. **Data Analysis** — Characterization complete, processing results 9. **Done** — Results available for download **Canceled** is a terminal state reachable from Draft, In Review, Waiting for Confirmation, or In Queue. ## Experiment Types | Type | Description | Target Required | |------|-------------|-----------------| | `screening` | High-throughput binding assessment | Yes | | `affinity` | Kinetic characterization (KD, kon, koff) | Yes | | `thermostability` | Thermal stability measurement (Tm) | No | | `expression` | Expression yield assessment | No | | `fluorescence` | Fluorescence-based characterization | No | ## Typical Workflow ``` POST /experiments # Create experiment POST /experiments/cost-estimate # Preview pricing POST /experiments/{id}/submit # Submit for review GET /experiments/{id}/quote # Retrieve quote when ready POST /experiments/{id}/quote/confirm # Accept quote GET /experiments/{id} # Monitor progress GET /results?experiment_id={id} # Retrieve results when done ``` ## Related Resources - [Results](#tag/results) — Characterization data from completed experiments - [Sequences](#tag/sequences) — Individual sequences within experiments - [Targets](#tag/targets) — Target proteins for binding experiments - name: feedback description: >- Use this endpoint to give us feedback, report bugs that are not already caught by our observability or request features (or have your agents do it). - name: info description: >- Programmatic discovery and health probes. Anonymous-eligible liveness and database connectivity probes; admin-only assay-type catalog (internal builds). - name: quotes description: >- Stripe quote lifecycle: list, retrieve, confirm, and reject quotes for experiment pricing. - name: results description: > Results contain the characterization data from completed experiments. ## Result Availability Results appear when an experiment reaches the **Done** status. Some experiment types provide partial results during **Data Analysis**. ## Result Types by Experiment | Experiment Type | Result Data | |-----------------|-------------| | Affinity | KD, kon, koff, sensorgrams | | Screening | Binding yes/no, response units | | Thermostability | Tm values, melting curves | | Expression | Yield measurements | ## Downloading Results Use the result `id` to fetch detailed data. Result downloads may include: - Raw sensorgram data - Fitted kinetic parameters - Quality metrics - Summary reports ## Related Resources - [Experiments](#tag/experiments) — Parent resource that produces results - name: sequences description: > Sequences provide read-only access to protein sequences submitted across experiments. ## Sequence Format Sequences are amino acid strings in standard single-letter IUPAC format (e.g., `MKTLLLTLLV...`). ## Sequence Properties | Field | Description | |-------|-------------| | `aa_string` | The amino acid sequence | | `name` | Optional human-readable identifier | | `control` | Whether this is a control sequence | | `metadata` | Structural annotations (tag location, antibody type) | ## Querying Sequences Filter sequences by experiment or other criteria: ``` GET /sequences?experiment_id={id} GET /sequences?name=mAb-001 ``` ## Related Resources - [Experiments](#tag/experiments) — Parent resource containing sequences - name: targets description: > Targets represent the molecules your samples will be tested against in binding experiments (affinity and screening). ## Target Catalog Adaptyv maintains a catalog of pre-validated target proteins with established pricing. Use `selfservice_only=true` to filter for targets with immediate pricing availability. ## Self-Service vs Custom Targets | Category | Description | Pricing | |----------|-------------|---------| | Self-service | Pre-validated catalog targets | Instant quote via cost estimate | | Custom | User-supplied or special request | Requires manual quote | ## Usage 1. Browse targets with `GET /targets?selfservice_only=true` 2. Use the target's `id` when creating an experiment 3. For custom targets, provide a `requested_target` object in the experiment request ## Related Resources - [Experiments](#tag/experiments) — Create experiments using targets - [Cost Estimate](#operation/cost_estimate) — Preview pricing for self-service targets - name: tokens description: > Create restricted versions of your API token for delegation to team members or automated systems. ## Token Attenuation Attenuation **reduces** the permissions of your token—it cannot grant additional access. Attenuated tokens inherit a subset of the parent token's capabilities. ## Restriction Types | Restriction | Effect | |-------------|--------| | Organization | Limit access to specific organizations | | Resource | Limit to specific resource types (experiments, results) | | Action | Limit to specific actions (read, create, update) | | Expiry | Set a shorter expiration time | ## Security Best Practices - Create narrowly-scoped tokens for automated systems - Use short expiration times for temporary access - Revoke tokens promptly when no longer needed - name: updates description: >- Real-time feed of experiment status changes, progress notifications, and operational alerts. Supports cursor-based pagination for efficient polling. - name: whoami description: >- Identify yourself: the organizations your token can access (with the active one marked), your user id, the permissions your token grants, and its expiry. paths: /api/v1/targets/request-custom: post: tags: - targets summary: Submit custom target request description: >- Submit a new custom target (antigen) for staff review. At least one of `sequence` or `pdb_id` must be provided. The `product_id` must be unique within your organization. New requests are created with `pending_review` status. Staff will review and approve or reject the request. Approved targets receive a `material_id` linking them to the catalog. operationId: create_custom_target_request requestBody: content: application/json: schema: $ref: '#/components/schemas/CreateCustomTargetRequest' required: true responses: '201': description: Request submitted successfully content: application/json: schema: $ref: '#/components/schemas/CreateCustomTargetResponse' '400': description: >- Validation failed (missing sequence/pdb, invalid sequence format, duplicate product_id) content: application/json: schema: $ref: '#/components/schemas/ErrorResponse' '401': description: Invalid or missing authentication token content: application/json: schema: $ref: '#/components/schemas/ErrorResponse' '403': description: Insufficient permissions content: application/json: schema: $ref: '#/components/schemas/ErrorResponse' '500': description: Internal server error content: application/json: schema: $ref: '#/components/schemas/ErrorResponse' components: schemas: CreateCustomTargetRequest: type: object description: >- Request payload for submitting a custom target with sequence or PDB data. Users can submit their own targets for review. At least one of `sequence` or `pdb_id` must be provided. Approved targets are added to the catalog and can be used in experiments. required: - name - product_id properties: molecular_weight: type: - number - 'null' format: double description: Molecular weight in kilodaltons (kDa) example: 15.5 name: type: string description: Display name for the target example: My Custom Antigen note: type: - string - 'null' description: Additional notes or context about the target example: Expressed in HEK293 cells pdb_file: type: - string - 'null' description: Base64-encoded PDB file content for custom structures not in the PDB pdb_id: type: - string - 'null' description: PDB database identifier (e.g., "1ABC", "6LU7") example: 1HHO product_id: type: string description: User-provided identifier, must be unique within your organization example: CUSTOM-001 product_url: type: - string - 'null' description: URL to vendor product page or documentation example: https://www.acrobiosystems.com/product/PD1 sequence: type: - string - 'null' description: >- Amino acid sequence using standard single-letter codes (A-Z excluding B, J, X, Z). Supports standard 20 amino acids plus selenocysteine (U) and pyrrolysine (O). example: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH vendor: type: - string - 'null' description: Source vendor name if applicable example: ACRO Biosystems CreateCustomTargetResponse: type: object description: Response after submitting a custom target request. required: - id - status - created_at properties: created_at: type: string format: date-time description: ISO 8601 timestamp when the request was created id: type: string format: uuid description: Unique identifier assigned to the request status: $ref: '#/components/schemas/CustomTargetRequestStatus' description: Current status (always "pending_review" for new submissions) ErrorResponse: type: object description: >- Error response body returned by all endpoints on 4xx/5xx failures. Every error response contains a human-readable message and the request ID for support correlation. The `request_id` is also returned in the `x-request-id` response header. required: - error - request_id properties: error: type: string description: Human-readable error description. example: experiment not found request_id: type: string description: >- Request identifier for support correlation (also in `x-request-id` header). example: req_019462a4-b1c2-7def-8901-23456789abcd CustomTargetRequestStatus: type: string description: Review status for custom target requests. enum: - pending_review - approved - rejected securitySchemes: adaptyv_biscuits_v0: type: http scheme: bearer bearerFormat: Adaptyv Biscuits v0 description: >- Biscuit-based bearer token. Obtain tokens from the Adaptyv Portal or via the `/tokens` endpoint. Tokens encode organization membership and role-based capabilities; the API verifies the token's cryptographic signature and authorization claims before processing requests. Use `/tokens/attenuate` to create restricted tokens for delegation. ````